- Recombinant Human Transmembrane protein 218 (TMEM218)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1122019
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 12,459 Da
- E Coli or Yeast
- 1-115
- transmembrane protein 218
- Transmembrane protein 218 (TMEM218)
Sequence
MAGTVLGVGAGVFILALLWVAVLLLCVLLSRASGAARFSVIFLFFGAVIITSVLLLFPRAGEFPAPEVEVKIVDDFFIGRYVLLAFLSAIFLGGLFLVLIHYVLEPIYAKPLHSY